| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 696381 | Complete | Structure prediction | shehan475 | BLM | 38 | 11 Dec 2025 | 25 Jan 2026 |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 687062 | 1 | 1 | 0.82 | RoseTTAFold | 1-38 | 38 | 11 Dec 2025 |
1 . 10 . 20 . 30 .
sequence: VTPEKICASNRLISTLENLYERKLLARFVIDEAHCVSQ
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington