1a3k-38kMRFsol-1 Domain 1 Parse 1 Confidence: n/a
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 696504 | Complete | Structure prediction | gsdsdt | 1a3k-38kMRFsol-1 | 171 | 12 Dec 2025 | 26 Jan 2026 |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 687181 | 1 | 1 | 0.87 | RoseTTAFold | 1-171 | 171 | 12 Dec 2025 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170
sequence: GPVAEVFLEPKWLLVLTGDRVTLKCVGEFSPSDKSVEWIHNNSEIGSKEETLEIGSATLEDAGDYRCRSNLSSLSDPLTLTVSEGRLLLGAPDLLFKVNEPLHLRCEAAVGKTLKNVVFLLNGKLLKKSEEPVDFDIPYATLEDAGEYRCEGYVGDELVRSEEVRLTVSAG
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington