| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 696639 | Complete | Structure prediction | aishwarya70 | AP02503 | 40 | 13 Dec 2025 | 27 Jan 2026 |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 687293 | 1 | 1 | 0.96 | RoseTTAFold | 1-40 | 40 | 13 Dec 2025 |
1 . 10 . 20 . 30 . 40
sequence: GWLKKFGKKIERVGQHTRDATIQAIGVAQQAANVAATLKG
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington