DLGAP5_RF3 Domain 1 Parse 1 Confidence: n/a
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 696821 | Complete | Structure prediction | AmrutPhutane | DLGAP5_RF3 | 150 | 16 Dec 2025 | 30 Jan 2026 |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 687465 | 1 | 1 | 0.47 | RoseTTAFold | 1-150 | 150 | 16 Dec 2025 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150
sequence: IKGKNSFAPKDFMFQPLDGLKTYQVTPMTPRSANAFLTPSYTWTPLKTEVDESQATKEILAQKCKTYSTKTIQQDSNKLPCPLGPLTVWHEEHVLNKNEATTKNLNGLPIKEVPSLERNEGRIAQPHHGVPYFRNILQSETEKLTSHCFE
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington