Multiepitopica Domain 1 Parse 1 Confidence: 0.23

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
696844CompleteStructure prediction pmosquera9525Multiepitopica7016 Dec 202530 Jan 2026
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
687486110.23ab initio1-707016 Dec 2025
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70
   sequence: TTRTGDTIYGFNSNTEKKFVYGEAMDSTPASPDWKKFVYGEAMDSTPASPDWKKTTRTGDTIYGFNSNTE
 deepconcnf: ------EEEEE-----EEEEE----------------EE----------------EEE--EEEEE-----
    psipred: -------EEE------EEEEEEEE---------HHHHH--EE------------------EEE-------
    spider3: ------EEE------EEEEEE-EE-----------EEEE-EE----------------------------
| | View
Powered by 3Dmol.js




Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington