| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 697099 | Active | Structure prediction | Abhishek_555 | Target_X | 58 | 19 Dec 2025 | 3 Feb 2026 |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 687715 | 1 | 1 | n/a | ab initio | 1-58 | 58 | 19 Dec 2025 |
1 . 10 . 20 . 30 . 40 . 50 .
sequence: ADQLTPTWRVYSTGSGGGGSADQLTPTWRVYSTGSNGGGGSADQLTPTWRVYSTGSNV
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington