1BK2_1 Domain 1 Parse 1 Confidence: n/a

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
697765CompleteStructure prediction alicia.alonso11BK2_15729 Dec 202512 Feb 2026
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
68830211n/acomparative modeling1-575729 Dec 2025
             1   .   10    .   20    .   30    .   40    .   50    .  
   sequence: KELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNGRQGFVPAAYVKKLD
| Download | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington