| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 698188 | Complete | Structure prediction | jupyt3r | 2vuu_17_A | 42 | 6 Jan 2026 | 20 Feb 2026 |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 688665 | 1 | 1 | 0.90 | RoseTTAFold | 1-42 | 42 | 6 Jan 2026 |
1 . 10 . 20 . 30 . 40
sequence: TTCTNCFTQTTPLWRRNPEGQPLCNACGLFLKLHGVVRPLSL
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington