Structure prediction of GA98 Domain 1 Parse 1 Confidence: n/a
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 698240 | Complete | Structure prediction | ejhafey | Structure prediction of G... | 56 | 6 Jan 2026 | 20 Feb 2026 |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 688705 | 1 | 1 | 0.62 | RoseTTAFold | 1-56 | 56 | 6 Jan 2026 |
1 . 10 . 20 . 30 . 40 . 50 .
sequence: TTYKLILNLKQAKEEAIKELVDAGTAEKYFKLIANAKTVEGVWTLKDEIKTFTVTE
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington