Strep Protein G binding domain Gb Domain 1 Parse 1 Confidence: n/a

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
698504CompleteStructure prediction slkeatsStrep Protein G binding d...568 Jan 202622 Feb 2026
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
688939110.77RoseTTAFold1-56568 Jan 2026
             1   .   10    .   20    .   30    .   40    .   50    . 
   sequence: TTYKLILNLKQAKEEAIKELVDAGTAEKYFKLIANAKTVEGVWTYKDEIKTFTVTE
| | View
Powered by 3Dmol.js




Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington