Plasmic2 Domain 1 Parse 1 Confidence: n/a
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 698752 | Complete | Structure prediction | Joanna | Plasmic2 | 65 | 12 Jan 2026 | 26 Feb 2026 |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 689203 | 1 | 1 | 0.71 | RoseTTAFold | 1-65 | 65 | 12 Jan 2026 |
1 . 10 . 20 . 30 . 40 . 50 . 60 .
sequence: GVQKQFKVIEKLVSDCEGGGGSNIDPQPDFKAFKENLEAQAGPGGGGSKKYLFKAHDFFEEHGKV
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington