maestro_model1_HD_parallel.pdb Domain 1 Parse 1 Confidence: n/a

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
698987CompleteStructure prediction bernadoganmaestro_model1_HD_paralle...3213 Jan 202627 Feb 2026
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
68943011n/acomparative modeling1-323213 Jan 2026
             1   .   10    .   20    .   30  
   sequence: LVAFHLGLLFVWLCQNLYYFSYPLFVGFALLR
| | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington