| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 699306 | Complete | Structure prediction | SneXav | candidalysin | 32 | 17 Jan 2026 | 3 Mar 2026 |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 689704 | 1 | 1 | 0.93 | RoseTTAFold | 1-32 | 32 | 17 Jan 2026 |
1 . 10 . 20 . 30
sequence: ISFAGIVSSIINQLPSIIQIIGNIIKAGLVKR
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington