PRPRSTVWYAMNPRSTVWYACVWY Domain 1 Parse 1 Confidence: n/a
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 699392 | Complete | Structure prediction | Michael- | PRPRSTVWYAMNPRSTVWYACVWY | 407 | 19 Jan 2026 | 5 Mar 2026 |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 689799 | 1 | 1 | 0.27 | RoseTTAFold | 1-407 | 407 | 19 Jan 2026 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 . 230 . 240 . 250 . 260 . 270 . 280 . 290 . 300 . 310 . 320 . 330 . 340 . 350 . 360 . 370 . 380 . 390 . 400 .
sequence: PRPRSTVWYAMNPRSTVWYACVWYPRPRSTVWYAMNPRSTVWYACVWYPRPRSTVWYAMNPRSTVWYACVWYPRPRSTVWYAMNPRSTVWYACVWYPRPRSTVWYAMNPRSTVWYACVWYPRPRSTVWYAMNPRSTVWYACVWYPRPRSTVWYAMNPRSTVWYACVWYPRPRSTVWYAMNPRSTVWYACVWYPRPRSTVWYAMNPRSTVWYACVWYPRPRSTVWYAMNPRSTVWYACVWYPRPRSTVWYAMNPRSTVWYACVWYPRPRSTVWYAMNPRSTVWYACVWYPRPRSTVWYAMNPRSTVWYACVWYPRPRTVWYAMNPRSTVWYACVWYPRPRSTVWYAMNPRSTVWYACVWYPRPRSTVWYAMNPRSTVWYACVWYPRPRSTVWYAMNPRSTVWYACVWY
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington