ND4L Paratapes textilis Domain 1 Parse 1 Confidence: n/a
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 699596 | Complete | Structure prediction | nitinwasnik | ND4L Paratapes textilis | 89 | 20 Jan 2026 | 6 Mar 2026 |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 689987 | 1 | 1 | 0.64 | RoseTTAFold | 1-89 | 89 | 20 Jan 2026 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 .
sequence: MFVFFSLLCVLWQEKFFLNVLLLFEFFMLSLVLLCIYGGMLKMNTMVAYACIMVLCLDVSGAVLGLALLVNSSRVASKSGVFSFSFLSF
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington