DENV1_32 Domain 1 Parse 1 Confidence: n/a
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 699652 | Active | Structure prediction | iinquimboy | DENV1_32 | 50 | 21 Jan 2026 | 7 Mar 2026 |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 690046 | 1 | 1 | n/a | RoseTTAFold | 1-50 | 50 | 21 Jan 2026 |
1 . 10 . 20 . 30 . 40 . 50
sequence: AETQHGTVLGGGSYEGTDAPCKIPFSSQDGGGSTANPIVTDKEKPVNIEA
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington