LmxM.28.3030partial Domain 1 Parse 1 Confidence: n/a

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
699664CompleteStructure prediction jpomacedoLmxM.28.3030partial56421 Jan 20267 Mar 2026
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
69007111n/acomparative modeling1-56456421 Jan 2026
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    
   sequence: MTNASSLAAPKELFIAEPIGGFGANHSTTPSHALLNGAAAGLAASGAGTPPKALLNGAAAGLAASGADTSPKALLNGAAAGLAASGADTPPKALLNGAAAGLAASGADTPPKALLNGAAAGLAASGADTSPKALLNGAAAGLAASGADTPPKALLNGAAAGLAASGADTSPKALLNGAAAGLAASGADTSPKALLNGAAAGLAASGADTPPKALLNGAAAGLAASGADTSPKALLNGAAAGLAASGADTSPKALLNGAAAGLAASGADTSPKALLNGAAAGLAASGADTPPKALLNGAAAGLAASGADTPPKALLNGAAAGLAASGADTSPKALLNGAAAGLAASGADTPPKALLNGAAAGLAASGADTSPKALLNGAAAGLAASGADTSPKALLNGAAAGLAASGADTPPKALLNGAAAGLAASGADTSPKALLNGAAAGLAASGADTSPKALLNGAAAGLAASGADTPPKALLNGAAAGLAASGADTSPKALLNGAAAGLAASGADTSPKALLNGAAAGLAASGADTSPKALLNGAAAGLAASGADTPPKALLNGAVPAGML
| Download | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington