test30_1 Domain 1 Parse 1 Confidence: 0.00

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
699622Domain completeStructure predictionwevangelistatest30_13520 Jan 20268 Mar 2026
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
690127110.00comparative modeling1-353522 Jan 2026
             1   .   10    .   20    .   30    .
   sequence: DCWVHSCIITTDTSQRSKLSNTGHPYEMHREPPQF
 deepconcnf: ---EEEEEEE-------------------------
    psipred: ---EEEEEEE----HHHH-------HHH-------
    spider3: ----EEEEEE-------------------------
| | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Alignment cluster 2 [ RosettaCM constraints ]

Alignment cluster 3 [ RosettaCM constraints ]

Alignment cluster 4 [ RosettaCM constraints ]

Alignment cluster 5 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington