TNFR1 Domain 1 Parse 1 Confidence: 0.60

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
699960CompleteStructure prediction EmmaEtLucieTNFR116225 Jan 202611 Mar 2026
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
690339110.60comparative modeling1-16216225 Jan 2026
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160  
   sequence: MDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIEN
| Download | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington