ligand 8P6Q.pdb Domain 1 Parse 1 Confidence: 0.90

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
699974CompleteStructure prediction MVABligand 8P6Q.pdb4525 Jan 202611 Mar 2026
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
690351110.90comparative modeling1-454525 Jan 2026
             1   .   10    .   20    .   30    .   40    .
   sequence: SCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFN
| Download | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington