IAPP Domain 1 Parse 1 Confidence: 0.37

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
700165CompleteStructure prediction a-ziajIAPP8927 Jan 202613 Mar 2026
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
690542110.37comparative modeling1-898927 Jan 2026
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .    
   sequence: MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYGKRNAVEVLKREPLNYLPL
| Download | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Alignment cluster 2 [ RosettaCM constraints ]

Alignment cluster 3 [ RosettaCM constraints ]

Alignment cluster 4 [ RosettaCM constraints ]

Alignment cluster 5 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington