8um9_1_A Domain 1 Parse 1 Confidence: 0.98

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
700220CompleteStructure prediction sks8um9_1_A5528 Jan 202614 Mar 2026
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
690619110.98comparative modeling1-555528 Jan 2026
             1   .   10    .   20    .   30    .   40    .   50    .
   sequence: MQYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVGEWTYDDATKTFTVTE
| Download | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington