I20V_CM Domain 1 Parse 1 Confidence: 0.37

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
701005CompleteStructure prediction haramosI20V_CM626 Feb 202623 Mar 2026
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
691333110.37comparative modeling1-62626 Feb 2026
             1   .   10    .   20    .   30    .   40    .   50    .   60  
   sequence: MPRRQWRWTRMTLTRAHYKVDGQLCLHWRPNSENLRGNLQIWWQLKNWLQNQLIQQGLSLMI
| | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Alignment cluster 2 [ RosettaCM constraints ]

Alignment cluster 3 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington