N2.pdb Domain 1 Parse 1 Confidence: n/a
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 701879 | Complete | Structure prediction | lalithperera | N2.pdb | 79 | 26 Feb 2026 | 12 Apr 2026 |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 692232 | 1 | 1 | n/a | comparative modeling | 1-79 | 79 | 26 Feb 2026 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 .
sequence: GTLCNFCKHNGESRHVYSSHQLKTPDGVVVCPILRHYVCPVCGATGDQAHTLKYCPLNGGQQSLYRRSGRNSAGRRVKR
>692232
GTLCNFCKHNGESRHVYSSHQLKTPDGVVVCPILRHYVCPVCGATGDQAHTLKYCPLNGGQQSLYRRSGRNSAGRRVKR
>user1_w100 weight: 1.0000 score: 0.0 eval: n/a prob: n/a identity: 0.7215 startpos: 1
-TLCNFCKHNGESRHVYSSHQLKTPDGVVVCPILRHYVCPVCGATGDQAHTLKYCPLN---------------------
Powered by MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington