LSCM1_07517 Domain 1 Parse 1 Confidence: n/a

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
701897CompleteStructure prediction jpomacedoLSCM1_0751710626 Feb 202612 Apr 2026
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
69224711n/acomparative modeling1-10610626 Feb 2026
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    . 
   sequence: MSYHAISPTTAVRHGGDAARCRQPGGAFSAKHVFPVMRAGARIAAHDSRNGAGGWGRHGPPFPLRLAHNGAPAPLTGSSFPGQRSLTTARTAATGASTRKERLRGL
| Download | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington