3I40.pdb Domain 1 Parse 1 Confidence: n/a
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 701905 | Complete | Structure prediction | Anudhritiboruah | 3I40.pdb | 51 | 27 Feb 2026 | 13 Apr 2026 |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 692260 | 1 | 1 | n/a | comparative modeling | 1-51 | 51 | 27 Feb 2026 |
1 . 10 . 20 . 30 . 40 . 50
sequence: MLLELCGKYWGSEEELLELCEMNDTWIFGEELLELLLEEAGDEGFFYDPDE
>692260
MLLELCGKYWGSEEELLELCEMNDTWIFGEELLELLLEEAGDEGFFYDPDE
>user1_w100 weight: 1.0000 score: 0.0 eval: n/a prob: n/a identity: 0.0980 startpos: 1
GIVEQCCTSICSLYQLENYCN------------------------------
Powered by MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington