LSCM1_05724 Domain 1 Parse 1 Confidence: n/a

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
701989CompleteStructure prediction jpomacedoLSCM1_05724642 Mar 202616 Apr 2026
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
69232511n/acomparative modeling1-64642 Mar 2026
             1   .   10    .   20    .   30    .   40    .   50    .   60    
   sequence: MGPRPRRPYPCRTAASGTVRSGSLFLVYVFVPVEAVAHRHVAGTSALAAFCGGRRGSSTEIYAQ
| Download | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington