LSCM1_06011 Domain 1 Parse 1 Confidence: n/a

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
702041CompleteStructure prediction jpomacedoLSCM1_06011505 Mar 202619 Apr 2026
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
69236211n/acomparative modeling1-50505 Mar 2026
             1   .   10    .   20    .   30    .   40    .   50
   sequence: MLHLYRGYGTAVSMRKVGVRNAAAEPLGRKGGGRRAPWRQRAPRPVKRSC
| Download | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington