LINF_310009500 Domain 1 Parse 1 Confidence: n/a

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
702042CompleteStructure prediction jpomacedoLINF_310009500755 Mar 202619 Apr 2026 (65:43:22)
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
69236311n/acomparative modeling1-75755 Mar 2026
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .
   sequence: MKFTKAKVCHAQGALVTNSRSQAQYPFFCVPSQQPSVHPMPARKGHTHKKHLCTHLHICIHVYVSLFSVVLFLFL
| Download | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington