E1B1 Domain 1 Parse 1 Confidence: 0.24

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
702272CompleteStructure prediction Sherry717CQMUE1B19512 Mar 202628 Apr 2026
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
692526110.24comparative modeling1-959514 Mar 2026
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .
   sequence: MERRNPSERGVPAGFSGHASVESGCETQESPATVVFRPPGDNTDGGAAAAAGGSQAAAAGAEPMEPESRPGPSGMNVVQVAELYPELRRILTITE
| Download | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Alignment cluster 2 [ RosettaCM constraints ]

Alignment cluster 3 [ RosettaCM constraints ]

Alignment cluster 4 [ RosettaCM constraints ]

Alignment cluster 5 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington