2026-03-14_00000162_full_19 Domain 1 Parse 1 Confidence: 0.00
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 702329 | Active | Structure prediction | RoseTTAFold | 2026-03-14_00000162_full_... | 124 | 14 Mar 2026 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 692533 | 1 | 1 | n/a | RoseTTAFold | 1-124 | 124 | 14 Mar 2026 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120
sequence: MTAQQTVEAFIANWPKADRLYPSVREYFTADCRYENIGVSKTTGPEEAIAWFTMMSTRLPFVSIDVDMLAIAAHGDTVLTERIDYLKDKDGNTLLTIPLMGIFKLRDGKICEWRDYFDTTPFKG
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington