LSCM1_04541 Domain 1 Parse 1 Confidence: n/a
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 702487 | Complete | Structure prediction | jpomacedo | LSCM1_04541 | 67 | 22 Mar 2026 | 6 May 2026 |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 692658 | 1 | 1 | n/a | comparative modeling | 1-67 | 67 | 22 Mar 2026 |
1 . 10 . 20 . 30 . 40 . 50 . 60 .
sequence: MRMTRTTPSASRTRRPTGGGGGRRWCRSHTAPPKPCSRGGPQGCTRKAASAKPPSHEDALTPCRKKE
>692658
MRMTRTTPSASRTRRPTGGGGGRRWCRSHTAPPKPCSRGGPQGCTRKAASAKPPSHEDALTPCRKKE
>user1_w100 weight: 1.0000 score: 0.0 eval: n/a prob: n/a identity: 1.0000 startpos: 1
MRMTRTTPSASRTRRPTGGGGGRRWCRSHTAPPKPCSRGGPQGCTRKAASAKPPSHEDALTPCRKKE
Powered by MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington