ab_initio_test1 Domain 1 Parse 1 Confidence: 0.48

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
702530CompleteStructure prediction tsukimotoab_initio_test18024 Mar 20268 May 2026
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
692679110.48ab initio1-808024 Mar 2026
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80
   sequence: ACDEFGHIKLMNPQRSTVWYACDEFGHIKLMNPQRSTVWYACDEFGHIKLMNPQRSTVWYACDEFGHIKLMNPQRSTVWY
 deepconcnf: -------EEEE-----EEEEEE-----EEEE-----EEEEEE-----EEEE-----EEEEEE-----EEEE-----EEE-
    psipred: -------EEEE-----EEEEEE-----EEEE-----EEEEEE-----EEEE-----EEEEEE-----EEE----------
    spider3: -------EE--------EEEEEEEE-EEEE------EEEEEEEEE-EEEE------EEEEEEEEE-EEEE----------
| | View
Powered by 3Dmol.js




Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington