PHB2.pdb Domain 1 Parse 1 Confidence: 0.93

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
702808CompleteStructure prediction TaiPHB2.pdb1215 Apr 202620 May 2026
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
692875110.93comparative modeling1-1211215 Apr 2026
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120 
   sequence: MPSEKSFKQRRSFTERVKDVELIRSQHPNKIPVIIERYRGEKQLPMLDKTKFLVPDHVNMSELVKIIRRRLQLNPNQAFFLLVNQRSMVSVAAPICEVYEQERDDDGFLYMVYASQETFGF
| Download | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington