Novel protein_NP7_2.4.2026 Domain 1 Parse 1 Confidence: 0.00

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
702835CompleteStructure prediction APARNANovel protein_NP7_2.4.202...758 Apr 202623 May 2026
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
692901110.00comparative modeling1-75758 Apr 2026
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .
   sequence: MNPLEMQRKGPPRRWCLQVYPTAPKRQRPSRTGHDDDGGFVEKKRGKCGEKQERSDCYCVCVERSRHGRLHFVMC
| Download | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Alignment cluster 2 [ RosettaCM constraints ]

Alignment cluster 3 [ RosettaCM constraints ]

Alignment cluster 4 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington