2026-04-18_00000083_full_19 Domain 1 Parse 1 Confidence: 0.00
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 703089 | Active | Structure prediction | RoseTTAFold | 2026-04-18_00000083_full_... | 111 | 19 Apr 2026 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 693039 | 1 | 1 | n/a | RoseTTAFold | 1-104 | 104 | 19 Apr 2026 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100
sequence: MSGYHHLRSDELHELSSKISSAVAAADLTAVRAALCQLDGVDVYLTELEDTKIGVAVGSVLSQPALKPLWPLARAMISFWARHLPAETLAAIRSVQQRQLPVLE
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington