| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 703096 | Active | Structure prediction | RoseTTAFold | 2026-04-18_00000350_full_... | 31 | 19 Apr 2026 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 693045 | 1 | 1 | n/a | RoseTTAFold | 1-31 | 31 | 19 Apr 2026 |
1 . 10 . 20 . 30
sequence: GEKDPILLTISILSFFSGALLVILAHVLWKK
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington