LINF_260010200 Domain 1 Parse 1 Confidence: n/a

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
703175CompleteStructure prediction jpomacedoLINF_2600102007421 Apr 20265 Jun 2026
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
69311211n/acomparative modeling1-747421 Apr 2026
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    
   sequence: MHGITKRMALLVFLLAANLGVLYLTVYVNTSSFVNFSEEMKVLAVRMQLPSPVLLFFAPSLSSTPFWRPPPPRS
| Download | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington