RAD50 - frameshift Domain 1 Parse 1 Confidence: 0.57

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
703384ExpiredStructure prediction hiba ashfaqRAD50 - frameshift871 May 202616 Jun 2026
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
693269110.57comparative modeling1-87872 May 2026
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .  
   sequence: MSSLNKLAIRGIRSFDDKQISIVFSPATVIVGHNGSGKTTIIECLKYATTGEQPPNTRGGAFVHDPKMANEKEVKAQVKLRFHSANG
| Download | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Alignment cluster 2 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington