T1021s3 Domain 2 Parse 1 Confidence: 0.45

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
486CompleteStructure predictioncaspT1021s329513 Jul 2018-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
700210.45comparative modeling221-2957513 Jul 2018
                 .  230    .  240    .  250    .  260    .  270    .  280    .  290    .
   sequence: AMTHVNLDSSPVANSDGSAAEIRVSLRVYGMTPTEYLAPMNTVFNEWEKSEAAAVTPDGYRVYINAVDKTDLTGI
 deepconcnf: ---EEEEEEEE-----------EEEEEEE-------HHHHHHHHHHHHH----EEEE--EEEEEEEEE---EEE-
    psipred: ---EEEEEEEEE-----------EEEEE----HHHHHHHHHHHHHHHH---HHHHHHH---EEEEE---------
    spider3: EE-EEEEEEEE-----------EEEEEE----HHHHHHHHHHHHHHHHH----EEEE----EEEEEE-----E--
| | View
Powered by 3Dmol.js
| | Alignment


Alignment cluster 1 [ RosettaCM constraints ]

Alignment cluster 2 [ RosettaCM constraints ]

Alignment cluster 3 [ RosettaCM constraints ]

Alignment cluster 4 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington