2021-05-01_00000046_1_11 Domain 1 Parse 1 Confidence: 0.00
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
73458 | Complete | Structure prediction | cameo | 2021-05-01_00000046_1_11 | 119 | 1 May 2021 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
71455 | 1 | 1 | 0.69 | TrRefineRosetta | 1-119 | 119 | 1 May 2021 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 .
sequence: ARKHVQELLKTFRRIDFDETRKSVYLQSAKFGVQSQLREPLTKKVLNYWDDVKLSKTCLDRMVTKVNDVKETFYAGFSYACESHNQYSVDCLEAAKPSYLTALGEIRGETEKCLTTRLK
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington