2021-05-22_00000305_1_19 Domain 1 Parse 1 Confidence: 0.46

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
77105CompleteStructure predictionRoseTTAFold2021-05-22_00000305_1_19139122 May 2021-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
75182110.46comparative modeling1-373722 May 2021
             1   .   10    .   20    .   30    .  
   sequence: MKRGFARPTPEKPPVIKPENIVLSTPLSIPPPEGKPW
    psipred: ----EE--------------EE---------------
    spider3: -------------------------------------
 deepconcnf: --------------------EEE--------------
| | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Alignment cluster 2 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington