2021-06-05_00000103_1_11 Domain 1 Parse 1 Confidence: 0.00

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
79724CompleteStructure predictioncameo2021-06-05_00000103_1_111675 Jun 2021-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
77610110.83TrRefineRosetta1-1671675 Jun 2021
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  
   sequence: TYKATHEFMSGTPGKELPQEVKDLLPADQTDLKDGSQATPTQPSKTEVKTAEGTWSFKSYDKTSETINGADAHFVGTWEFTPAPTYKATHEFVSGTPGKELPQEVKDLLPADQTDLKDGSQATPTQPSKTEVKTTEGTWSFKSYDKTSETINGADAHFVGTWEFTPA
| | View
Powered by 3Dmol.js




Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington