2021-06-05_00000103_1_11 Domain 1 Parse 1 Confidence: 0.00
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 79724 | Complete | Structure prediction | cameo | 2021-06-05_00000103_1_11 | 167 | 5 Jun 2021 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 77610 | 1 | 1 | 0.83 | TrRefineRosetta | 1-167 | 167 | 5 Jun 2021 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 .
sequence: TYKATHEFMSGTPGKELPQEVKDLLPADQTDLKDGSQATPTQPSKTEVKTAEGTWSFKSYDKTSETINGADAHFVGTWEFTPAPTYKATHEFVSGTPGKELPQEVKDLLPADQTDLKDGSQATPTQPSKTEVKTTEGTWSFKSYDKTSETINGADAHFVGTWEFTPA
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington