2021-07-03_00000091_2_11 Domain 1 Parse 1 Confidence: 0.00

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
88848CompleteStructure predictioncameo2021-07-03_00000091_2_11593 Jul 2021-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
86263110.80TrRefineRosetta1-59593 Jul 2021
             1   .   10    .   20    .   30    .   40    .   50    .    
   sequence: NEFDRIIENQEKSLKASKSTPDGTIKDRRLFMHHVSLEPITTVPFRTTKERQENLYFQG
| | View
Powered by 3Dmol.js




Baker Lab | Rosetta@home | Contact | Terms of Service
©2022 University of Washington