2021-07-03_00000213_1_19 Domain 4 Parse 1 Confidence: 0.29

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
88867CompleteStructure predictionRoseTTAFold2021-07-03_00000213_1_1923393 Jul 2021-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
86880410.29comparative modeling2124-23392165 Jul 2021
              . 2130    . 2140    . 2150    . 2160    . 2170    . 2180    . 2190    . 2200    . 2210    . 2220    . 2230    . 2240    . 2250    . 2260    . 2270    . 2280    . 2290    . 2300    . 2310    . 2320    . 2330    .    
   sequence: KQRFYSCDRFGGREPPKPKPSLSSHPTSPTAGQEPGPHPQGSGSVNGSPLLSTSGASTPGRGGRRQLPQTPLTPRPSITYKTANSSPIHFAGAQTSLPAFSPGRLSRGLSEHNALLQRDPLSQPLAPGSRIGSDPYLGQRLDSEASVHALPEDTLTFEEAVATNSGRSSRTSYVSSLTSQSHPLRRVPNGYHCTLGLSSGGRARHSYHHPDQDHWC
 deepconcnf: -----------------------------------------------------------------------------EEEE--------------------------------HHH----------------------------------------HHHHHHH-----------------------------------------------------
    psipred: ------------------------------------------------------------------------------EE----------------------------------------------------------------------------HHHHHH----------------------------EE------------------------
    spider3: -EE--------------------------------------------------------------------------EEE----------------------------------------------------------------------------HHHHHHH----------------------------EE-----------------------
| | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Alignment cluster 2 [ RosettaCM constraints ]

Alignment cluster 3 [ RosettaCM constraints ]

Alignment cluster 4 [ RosettaCM constraints ]

Alignment cluster 5 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2022 University of Washington