2021-07-03_00000213_1_19 Domain 1 Parse 2 Confidence: 0.26

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
88867CompleteStructure predictionRoseTTAFold2021-07-03_00000213_1_1923393 Jul 2021-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
86881120.26ab initio1-84845 Jul 2021
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    
   sequence: MVRFGDELGGRYGGPGGGERARGGGAGGAGGPGPGGLQPGQRVLYKQSIAQRARTMALYNPIPVKQNCFTVNRSLFVFSEDNVV
 deepconcnf: ----------------------------------------HHHHHHHHHHHHHHHHHHH---------------EEEEE-----
    psipred: ------------------------------------------HHHHHHHHHHHHHHHH-----HHH-------EEEEE------
    spider3: -----------------------------------------HHHHHHHHHHHHHHHHHH--------------EEEEE------
| | View
Powered by 3Dmol.js




Baker Lab | Rosetta@home | Contact | Terms of Service
©2022 University of Washington