2021-07-17_00000176_1_19 Domain 1 Parse 1 Confidence: 0.00
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
96488 | Complete | Structure prediction | RoseTTAFold | 2021-07-17_00000176_1_19 | 31 | 17 Jul 2021 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
91417 | 1 | 1 | 0.94 | RoseTTAFold | 1-31 | 31 | 17 Jul 2021 |
1 . 10 . 20 . 30
sequence: MITISTMLQFGLFLIALIGLVIKLIELSNKK
Baker Lab | Rosetta@home | Contact | Terms of Service
©2022 University of Washington