2021-07-17_00000178_2_19 Domain 1 Parse 1 Confidence: 0.00

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
96495CompleteStructure predictionRoseTTAFold2021-07-17_00000178_2_19120617 Jul 2021-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
91539110.00comparative modeling1-969618 Jul 2021
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    . 
   sequence: MDSAWSHPQFEKGGGSGGGSGGSAWSHPQFEKSAVDLEVLFQGPGMISAPDVVAFTKEEEYEEEPYNEPALPEEYSVPLFPFASQGANPWSKLSGA
 deepconcnf: -----------------------------------EEEEEE----------EEE------------------------------------------
    psipred: ----------------------------HHHH----EEEEE----------EEEE--HHH------------HH----------------HH----
    spider3: ------------------------------------EEEEEE---------EEEE-----------------------------------------
| | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Alignment cluster 2 [ RosettaCM constraints ]

Alignment cluster 3 [ RosettaCM constraints ]

Alignment cluster 4 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington