2021-07-17_00000178_2_19 Domain 3 Parse 1 Confidence: 0.94

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
96495CompleteStructure predictionRoseTTAFold2021-07-17_00000178_2_19120617 Jul 2021-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
91541310.94comparative modeling832-99616518 Jul 2021
                .  840    .  850    .  860    .  870    .  880    .  890    .  900    .  910    .  920    .  930    .  940    .  950    .  960    .  970    .  980    .  990    . 
   sequence: FQGGTSSGMKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYF
 deepconcnf: -------------EEEEEEE-----HHHHHHHHHHHHHHH--EEEEE----HHHHHHHH--------EEEEE---HHHHHH----------HHHH----HHHHHEEEE--EEEEEEEEEEEEEEEEE-------------HHHHHHHHHH---E-EEE-------
    psipred: --------------EEEEEE---HHHHHHHHHHHHHHHHH--EEEEEE-HHHHHHHHHHH-------EEEE---HHHHHHH----------HHHHHH--HHHHHHEEE--EEEEE-EEEEEEEEEEE----------HHHHHHHHHHHH---EEEEEEE------
    spider3: --------------EEEEEE-----HHHHHHHHHHHHHHH---EEEEE--HHHHHHHHHHH------EEEE-H-HHHHHHH----------HHHHHH--HHHHHHEEE--EEEEEEEEEEEEEEEEE----------HHHHHHHHHHHHH----EEEE-------
| | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2022 University of Washington