2021-07-17_00000178_2_19 Domain 4 Parse 1 Confidence: 1.00

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
96495CompleteStructure predictionRoseTTAFold2021-07-17_00000178_2_19120617 Jul 2021-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
91542411.00comparative modeling992-110711618 Jul 2021
                . 1000    . 1010    . 1020    . 1030    . 1040    . 1050    . 1060    . 1070    . 1080    . 1090    . 1100    .  
   sequence: QEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGIN
 deepconcnf: ------HHHHH-----------------------HHHHHHHHHHHHHHH---------HHHHHHHHH-----EEEE--------------EEEE---------------EEEEEE-
    psipred: ---HHHHHHHH-----EE--------HHH-----HHHHHHHHHHHHHHH---------HHHHHHHHH---EEEEEE-----HHHHH----EEEEE--------------EEEEEE-
    spider3: ------HHHHHH---EEE------E---------HHHHHHHHHHHHHHH---------HHHHHHHHH-----EEEE----HHHHHH----EEEEE-------------EEEEEEE-
| | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2022 University of Washington